ausbeautyblogausbeautybloggeraustraliabeautybourjoisbourjois pariscreamdrugstoremake-upmakeupmakeup blogmakeup reviewmattematte primerpricelineprimerreviewskinskincare
Review: Bourjois Happy Light Matte Serum Primer
ANYWAY it won't be a surprise to all of you that I saw this little Bourjois Happy Light Matte Serum Primer (15ml) diamond on sale at Priceline for $15. I snatched two of them up, one for me and one for my mother, but unfortunately it has gone back to $21 which is crummy but don't lose hope! More sales are always around the corner.
The Bourjois Happy Light Matte Serum Primer (15ml) bottle |
Another cheeky shot of the bottle |
Before I start, as you can see in the photographs above, a label on the lower portion of the bottle says that it's recommended for normal to combination skin. I have combination skin so it's suitable for me but might not be for people with oilier skin. Just keep that in mind.
When applying the product to my clean skin, it dried relatively quickly and as the bottle claims to do, it minimised my pores. It didn't completely eradicate my pores but they weren't as evident as they usually are.
I did notice however that after the product dried on my skin and "mattified" it, if I were to some reason rub my skin in the areas I placed the primer, the product would peel off immediately, leaving leaving plenty of white residue and flakes on my face. I'm assuming it does this because the primer creates a separate matte layer on top of your skin, so don't rub your face too harshly after the product dries on your face because it will come off and leave unpleasant flakes everywhere. Perhaps this is to be expected for matte creams but I've never used a matte primer before so I might be just completely ignorant on the matter... But I thought I'd point it out because I found it strange!
Appearance of the primer (in the photo it looks revolting but it's actually a light pink colour) |
- The consistency isn't too watery or too thick so it glides over the skin easily.
- Dries quickly
- It smells somewhat like baby wipes, but in a good way, it doesn't smell unpleasant in the slightest!
- Foundation glides on flawlessly
- Minimises pores slightly
- Make-up stays on and remains matte for a long time. If you're not doing anything strenuous your make-up should remain matte for a large portion of the day.
- The bottle pump releases the product in suitable quantities
Cons:
- I've found around 7/8 hours after applying my skin does become oily and shiny, so beware.
- Bit overpriced, I personally wouldn't pay $21 (full price) for a primer of that small quantity (15ml)
- Gets flaky if you rub your skin after the product dries (maybe it does this purely because it is a mattifying primer, so I'd just recommend to avoid doing this. Just apply foundation as normal after it's dried.)
- Doesn't completely conceal pores
Rating: ★★★★★
5/5 stars.
I'm giving this a generous rating because it's by far the best primer I've used. It makes my make-up stay flawless all day, and though my skin gets oily after 7/8 hours, a powder can easily conceal the shininess. If you want to splurge and take the risk of this item suiting your complexion then go and buy it but if you see it on sale, I'd say to definitely give it a try and hopefully it works for you!
xx
0 comments